PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013693P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 287aa    MW: 32278.7 Da    PI: 10.1394
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013693P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-391373262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+alkcprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg rknkk++
  MELO3C013693P1 13 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGFRKNKKKK 73
                    67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31166IPR003851Zinc finger, Dof-type
PfamPF027011.8E-331671IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3481771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAYRARLAMI PQPEAALKCP RCDSTNTKFC YFNNYSLSQP RHFCKACRRY WTRGGALRNV  60
PVGGGFRKNK KKKKTSNNRS KSPTPSQSQL GNSRSIMSRN CNNIESSNTT RDFPSHPSLQ  120
LPSINIIPSL QSQISRSFGN NFAGIHINNS TATAAREFDQ WQRFQQQPFL VAGLESPTTT  180
TTAAEYPEID VNNNNFGANS LQQSSGLVQY NNNNNCPHQQ QLQNLTQFSR IPMKNEEQNQ  240
EQGTMLSNFL RPIDQNNSQF WGSEHQNSWT DHHLSALSSS SSSHLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819180.0LN681918.1 Cucumis melo genomic scaffold, anchoredscaffold00020.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448399.10.0PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ9M2U12e-44DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A0A0KCA91e-156A0A0A0KCA9_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2466733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.21e-39OBF-binding protein 3